PRSS8 Antibody - middle region : FITC

PRSS8 Antibody - middle region : FITC
Artikelnummer
AVIARP56449_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRSS8

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostasin

Protein Size: 343

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56449_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56449_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5652
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×