PRUNE1 Antibody - C-terminal region : FITC

PRUNE1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57538_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the DHH protein superfamily of phosphoesterases. This protein has been found to function as both a nucleotide phosphodiesterase and an exopolyphosphatase. This protein is believed to stimulate cancer progression and metastases through the induction of cell motility. A pseuodgene has been identified on chromosome 13. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PRUNE

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: exopolyphosphatase PRUNE1

Protein Size: 241

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57538_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57538_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 58497
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×