PSG5 antibody - middle region (ARP42068_P050)

Description of Target: The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSG5

Key Reference: Okazaki,S., (2007) Obstet Gynecol 110 (5), 1130-1136

Molecular Weight: 38 kDa

Peptide Sequence: Synthetic peptide located within the following region: SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Pregnancy-specific beta-1-glycoprotein 5

Protein Size: 335

Purification: Affinity Purified

• Artikelnummer: AVIARP42068-P050
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP42068_P050
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5673
• Wirt: Rabbit
• Konjugat: Unconjugated