Psma2 Antibody - C-terminal region : HRP

Psma2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56454_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Psma2 is a component of the proteasome multicatalytic proteinase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proteasome subunit alpha type-2

Protein Size: 234

Purification: Affinity Purified

Subunit: alpha type-2
Mehr Informationen
Artikelnummer AVIARP56454_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56454_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29669
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×