PSMB10 Antibody - middle region : FITC

PSMB10 Antibody - middle region : FITC
Artikelnummer
AVIARP56474_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMB10

Key Reference: Liu,Y., (2007) DNA Seq. 18 (4), 257-264

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit beta type-10

Protein Size: 273

Purification: Affinity Purified

Subunit: beta type-10
Mehr Informationen
Artikelnummer AVIARP56474_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56474_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5699
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×