Psmc1 Antibody - C-terminal region : HRP

Psmc1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56476_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 26S protease regulatory subunit 4

Protein Size: 440

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP56476_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56476_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 19179
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×