Psmc1 Antibody - N-terminal region : Biotin

Psmc1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56475_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: YLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S protease regulatory subunit 4

Protein Size: 440

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP56475_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56475_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 19179
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×