PSMC4 Antibody - N-terminal region : HRP

PSMC4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56716_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC4

Key Reference: Marx,F.P., (2007) FASEB J. 21 (8), 1759-1767

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 26S protease regulatory subunit 6B

Protein Size: 418

Purification: Affinity Purified

Subunit: 6B
Mehr Informationen
Artikelnummer AVIARP56716_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56716_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5704
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×