Psmd10 Antibody - N-terminal region : HRP

Psmd10 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56481_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Psmd10 acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly,Psmd10 is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module By similarity.Psmd10 acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression of this gene is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Psmd10 regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 26S proteasome non-ATPase regulatory subunit 10

Protein Size: 231

Purification: Affinity Purified

Subunit: 10
Mehr Informationen
Artikelnummer AVIARP56481_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56481_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 53380
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×