PSMD12 Antibody - N-terminal region : HRP

PSMD12 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57839_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 3.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD12

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 26S proteasome non-ATPase regulatory subunit 12

Protein Size: 456

Purification: Affinity Purified

Subunit: 12
Mehr Informationen
Artikelnummer AVIARP57839_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57839_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5718
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×