PSPH Antibody - middle region : Biotin

PSPH Antibody - middle region : Biotin
Artikelnummer
AVIARP56589_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSPH

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoserine phosphatase

Protein Size: 225

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56589_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56589_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5723
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×