PTK6 Antibody - middle region : FITC

PTK6 Antibody - middle region : FITC
Artikelnummer
AVIARP56657_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epi

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTK6

Key Reference: Lukong,K.E. (2008) Cell. Signal. 20 (2), 432-442

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-tyrosine kinase 6

Protein Size: 451

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56657_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56657_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5753
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×