PTPN11 Antibody - N-terminal region : Biotin

PTPN11 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56493_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTN11

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: KSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tyrosine-protein phosphatase non-receptor type 11

Protein Size: 597

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56493_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56493_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5781
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×