PTS Antibody - N-terminal region : FITC

PTS Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56099_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTPS

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: SKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-pyruvoyl tetrahydrobiopterin synthase

Protein Size: 145

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56099_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56099_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5805
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×