PXT1 Antibody - middle region : HRP

PXT1 Antibody - middle region : HRP
Artikelnummer
AVIARP55566_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of PXT1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PXT1

Key Reference: Grzmil,P., Cytogenet. Genome Res. 119 (1-2), 74-82 (2007)

Molecular Weight: 6kDa

Peptide Sequence: Synthetic peptide located within the following region: MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisomal testis-specific protein 1

Protein Size: 51

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55566_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55566_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222659
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×