PYCR1 Antibody - middle region : FITC

PYCR1 Antibody - middle region : FITC
Artikelnummer
AVIARP57751_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR1

Key Reference: Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrroline-5-carboxylate reductase 1, mitochondrial

Protein Size: 316

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57751_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57751_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5831
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×