PYCR1 Antibody - middle region : HRP

PYCR1 Antibody - middle region : HRP
Artikelnummer
AVIARP57750_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR1

Key Reference: Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyrroline-5-carboxylate reductase 1, mitochondrial

Protein Size: 316

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57750_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57750_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5831
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×