PYCR2 Antibody - middle region : FITC

PYCR2 Antibody - middle region : FITC
Artikelnummer
AVIARP54937_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrroline-5-carboxylate reductase 2

Protein Size: 320

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54937_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54937_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 29920
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×