PYDC1 Antibody - N-terminal region : FITC

PYDC1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55560_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PYDC1 associates with apoptosis-associated specklike protein containing a CARD domain (ASC) and modulates its ability to collaborate with pyrin and cryopyrin in NF-kappa-B and pro- caspase-1 activation. It suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PYDC1

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: REAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrin domain-containing protein 1

Protein Size: 89

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55560_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55560_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 260434
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×