R3HDM2 Antibody - middle region : Biotin

R3HDM2 Antibody - middle region : Biotin
Artikelnummer
AVIARP55106_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human R3HDM2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: R3H domain-containing protein 2

Protein Size: 637

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55106_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55106_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22864
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×