Rab11A antibody (4H9)

Rab11A antibody (4H9)
Artikelnummer
GTX03669-100
Verpackungseinheit
100 μg
Hersteller
GeneTex

Verfügbarkeit: wird geladen...
Preis wird geladen...
Clone Name: 4H9

Application Note: WB: 0.25-0.5 μg/ml. ICC/IF: 5 μg/ml. IHC-P: 2-5 μg/ml. FACS: 1-3 μg/1x10⁶cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 24

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, no preservative.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot ID: P62491

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: RAB11A, member RAS oncogene family
Mehr Informationen
Artikelnummer GTX03669-100
Hersteller GeneTex
Hersteller Artikelnummer GTX03669-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Monoclonal
Methode Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Flow Cytometry, Immunocytochemistry
Isotyp IgG2b
Human Gene ID 8766
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF)
×