RAB11FIP2 Antibody - N-terminal region : Biotin

RAB11FIP2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55095_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP2

Molecular Weight: 58

Peptide Sequence: Synthetic peptide located within the following region: LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rab11 family-interacting protein 2

Protein Size: 512

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55095_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55095_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22841
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×