RAB11FIP5 Antibody - N-terminal region : HRP

RAB11FIP5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55260_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB11FIP5 is a Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP5

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rab11 family-interacting protein 5

Protein Size: 653

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55260_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55260_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26056
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×