RAB15 Antibody - middle region : FITC

RAB15 Antibody - middle region : FITC
Artikelnummer
AVIARP55918_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB15

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-15

Protein Size: 208

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55918_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55918_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 376267
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×