RAB15 Antibody - N-terminal region : Biotin

RAB15 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55917_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB15

Key Reference: Strick,D.J. (2005) Mol. Biol. Cell 16 (12), 5699-5709

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-15

Protein Size: 208

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55917_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55917_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 376267
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×