RAB15 Antibody - N-terminal region : HRP

RAB15 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55917_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB15

Key Reference: Strick,D.J. (2005) Mol. Biol. Cell 16 (12), 5699-5709

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-15

Protein Size: 208

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55917_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55917_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 376267
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×