Rab17 Antibody - N-terminal region : FITC

Rab17 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57631_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rab17 might be involved in transcellular transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rab17

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-17

Protein Size: 214

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57631_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57631_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 19329
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×