RAB1A Antibody - middle region : FITC

RAB1A Antibody - middle region : FITC
Artikelnummer
AVIARP56561_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB1A

Key Reference: Diao,A., (2008) J. Biol. Chem. 283 (11), 6957-6967

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-1A

Protein Size: 205

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56561_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56561_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5861
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×