RAB21 Antibody - C-terminal region : FITC

RAB21 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55140_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB21

Key Reference: N/A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-21

Protein Size: 225

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP55140_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55140_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23011
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×