RAB22A Antibody - middle region : Biotin

RAB22A Antibody - middle region : Biotin
Artikelnummer
AVIARP57434_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-22A

Protein Size: 194

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57434_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57434_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 57403
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×