Rab27a Antibody - middle region : FITC

Rab27a Antibody - middle region : FITC
Artikelnummer
AVIARP56564_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rab27a plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for both granule maturation and granule docking and priming at the immunologic synapse.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56564_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56564_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11891
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×