RAB27A Antibody - middle region : FITC

RAB27A Antibody - middle region : FITC
Artikelnummer
AVIARP56591_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscell

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB27A

Key Reference: Chiaverini,C., (2008) J. Biol. Chem. 283 (18), 12635-12642

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56591_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56591_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5873
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×