RAB3IL1 Antibody - middle region : Biotin

RAB3IL1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56739_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB3IL1

Key Reference: Krull,M., (2005) Mol. Biol. Evol. 22 (8), 1702-1711

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide exchange factor for Rab-3A

Protein Size: 382

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56739_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56739_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5866
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×