RAB5A Antibody - middle region : HRP

RAB5A Antibody - middle region : HRP
Artikelnummer
AVIARP56562_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB5A is required for the fusion of plasma membranes and early endosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB5A

Key Reference: Coyne,C.B., (2007) Cell Host Microbe 2 (3), 181-192

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-5A

Protein Size: 215

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56562_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56562_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5868
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×