Rab9b Antibody - N-terminal region : Biotin

Rab9b Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56895_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Rab9b may be involved in the transport of proteins between the endosomes and the trans Golgi network.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-9B

Protein Size: 201

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56895_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56895_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 319642
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×