RAB9B Antibody - N-terminal region : FITC

RAB9B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56894_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB9B

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-9B

Protein Size: 201

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56894_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56894_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51209
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×