RABGEF1 Antibody - N-terminal region : HRP

RABGEF1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55073_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RABGEF1 forms a complex with rabaptin-5 (RABPT5; MIM 603616) that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5 (RAB5A; MIM 179512) (Horiuchi et al., 1997 [PubMed 9323142]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RABGEF1

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ75284, highly similar to Homo sapiens RAB guanine nucleotide exchange factor (GEF) 1 (RABGEF1), mRNA EMBL BAF83367.1

Protein Size: 491

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55073_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55073_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27342
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×