Rad21 Antibody - N-terminal region : FITC

Rad21 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56709_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Rad21 Ensembl ENSRNOP00000006209

Protein Size: 635

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56709_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56709_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 314949
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×