RAD23B Antibody - middle region : Biotin

RAD23B Antibody - middle region : Biotin
Artikelnummer
AVIARP56505_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD23B

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UV excision repair protein RAD23 homolog B

Protein Size: 409

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56505_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56505_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5887
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×