RAGE Antibody - N-terminal region : HRP

RAGE Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56743_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAGE

Key Reference: Luo,H.R., (2001) Neuron 31 (3), 439-451

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAPK/MAK/MRK overlapping kinase

Protein Size: 419

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56743_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56743_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5891
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×