RALA Antibody - middle region : FITC

RALA Antibody - middle region : FITC
Artikelnummer
AVIARP56643_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RALA

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Ral-A

Protein Size: 206

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56643_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56643_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5898
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×