Rala Antibody - N-terminal region : Biotin

Rala Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56642_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Rala is a putative GTP binding protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Ral-A

Protein Size: 206

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56642_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56642_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81757
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×