Rala Antibody - N-terminal region : HRP

Rala Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56642_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rala is a putative GTP binding protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Ral-A

Protein Size: 206

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56642_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56642_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81757
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×