RAN Antibody - middle region : FITC

RAN Antibody - middle region : FITC
Artikelnummer
AVIARP56714_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAN

Key Reference: Abe,H., (2008) Int. J. Cancer 122 (10), 2391-2397

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding nuclear protein Ran

Protein Size: 216

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56714_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56714_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5901
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×