RAN Antibody - middle region : HRP

RAN Antibody - middle region : HRP
Artikelnummer
AVIARP56714_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAN

Key Reference: Abe,H., (2008) Int. J. Cancer 122 (10), 2391-2397

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding nuclear protein Ran

Protein Size: 216

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56714_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56714_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5901
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×