RANBP9 Antibody - Middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.

Immunogen: The immunogen for Anti-RANBP9 antibody is: synthetic peptide directed towards the Middle region of Human RANB9

Key Reference: N/A

Molecular Weight: 42 kDa

Peptide Sequence: Synthetic peptide located within the following region: FTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ran-binding protein 9

Protein Size: 388

Purification: Affinity purified

• Artikelnummer: AVIARP53634_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53634_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10048
• Wirt: Rabbit
• Konjugat: Conjugated, HRP