RAP1B Antibody - N-terminal region : HRP

RAP1B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56194_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAP1B and RAP1A (MIM 179520) belong to a superfamily of RAS (see MIM 190020)-like small GTP-binding proteins involved in cell signaling.RAP1B and RAP1A (MIM 179520) belong to a superfamily of RAS (see MIM 190020)-like small GTP-binding proteins involved in cell signaling.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-72 BG717530.1 20-91 73-172 BC000176.3 1-100 173-2026 BC000176.3 110-1963 2027-2117 AA809981.1 1-91 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAP1B

Key Reference: Bernardi,B., (2006) Blood 107 (7), 2728-2735

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rap-1b

Protein Size: 184

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56194_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56194_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5908
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×