RAP1GAP Antibody - middle region : FITC

RAP1GAP Antibody - middle region : FITC
Artikelnummer
AVIARP56512_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: TWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rap1 GTPase-activating protein 1

Protein Size: 663

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56512_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56512_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5909
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×