RAP1GAP Antibody - middle region : HRP

RAP1GAP Antibody - middle region : HRP
Artikelnummer
AVIARP56511_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP

Key Reference: Mitra,R.S., (2008) Cancer Res. 68 (10), 3959-3969

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rap1 GTPase-activating protein 1

Protein Size: 663

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56511_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56511_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5909
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×