RAPGEF1 Antibody - C-terminal region : FITC

RAPGEF1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54753_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAPGEF1

Key Reference: Niclas,J., (2007) Exp. Cell Res. 313 (18), 3881-3891

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rap guanine nucleotide exchange factor 1

Protein Size: 1077

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54753_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54753_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2889
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×